Protein Info for GFF2121 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: probable two-component sensor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 26 to 43 (18 residues), see Phobius details PF00512: HisKA" amino acids 78 to 143 (66 residues), 28.1 bits, see alignment E=2.5e-10 PF02518: HATPase_c" amino acids 188 to 296 (109 residues), 95.4 bits, see alignment E=4.5e-31 PF00072: Response_reg" amino acids 317 to 407 (91 residues), 40 bits, see alignment E=6.1e-14

Best Hits

KEGG orthology group: None (inferred from 33% identity to mno:Mnod_4194)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>GFF2121 probable two-component sensor (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLLFIQMPCVAAVAMFSEQAGQHYPVVIASLLFLLVGYAVATFRARERAYVRSALMERQE
EKNQLVQQLAQLQEAHAAKARLLAMVSHDLRQPVHALGLMLGRLRREASLSSLRVEVEAV
NEVVNSLSKSLTMLMAVTRLNSGQVTALSEAVSLERLFSSLSTEFDDTAGTNGMSVVLEA
NELTVRSDPHHLRTILINLLSNAIKYSSRGEVRIVATSPAPQTVVISVEDDGIGIPADDL
TRIFEPFVRLPYRKGSVDGIGLGLAIVKQTADLIKAPIEVESVVGRGTTFYLTLPRCEDL
QVVVAPAKDTYLRGVRIVVVDNDEIVLESMARTLEEWGCRVIAACDWNGLVAKLEMTSSP
IDLILTDFHLDAGLSGYELIKRVRKRLGVQVPSILLTGDVEIRHGPESTATAVVIAYKPL
PYEKLANLIQETISSFAREEPHAAP