Protein Info for GFF2120 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: FIG00554530: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 699 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 42 to 65 (24 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 109 to 134 (26 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 172 to 192 (21 residues), see Phobius details amino acids 213 to 235 (23 residues), see Phobius details PF03707: MHYT" amino acids 52 to 108 (57 residues), 72.1 bits, see alignment 4.3e-24 amino acids 115 to 166 (52 residues), 56 bits, see alignment 4.7e-19 amino acids 182 to 234 (53 residues), 28.4 bits, see alignment 1.9e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 257 to 419 (163 residues), 134.5 bits, see alignment E=1.5e-43 PF00990: GGDEF" amino acids 261 to 416 (156 residues), 150.1 bits, see alignment E=7.1e-48 PF00563: EAL" amino acids 438 to 672 (235 residues), 239.9 bits, see alignment E=3.8e-75

Best Hits

KEGG orthology group: None (inferred from 100% identity to stm:STM3388)

Predicted SEED Role

"FIG00554530: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (699 amino acids)

>GFF2120 FIG00554530: hypothetical protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MPVSEYNHILVAVSFAVAIFASYTALNMAGRVAGSARSNARIWLMGGGFALGVGIWAMHF
VGMLAMDHAMNMRFDPFLTGLSMLIAIGSSLFALWLVSAEKLRLRRLLPGALVMGLGISA
MHYTGMAALQFASIIVWNSAWVALSIIIALLASCGALWLTFRLRHEGTDVALRRAGAAVL
MGIAIAGMHYAGMKAAHFPQNWPMEHRGVDSNWLAVLVSVVALTILGITLLVSLFDARLQ
ARTALLASSLAQANQELAQLALHDTLTRLPNRVLLEDRLEQAISKANRENTSFALLFMDL
DGFKTVNDAYGHDIGDKLLVAVTHRLNQPLSGQFTLARIGGDEFVLLAEVSAPDEAASLA
SALVHSIDAPFTIDPYELVVTLSVGIALYPLDGKNERELMFNADAAMYHTKHTGRNGYHF
FQPSMNMLAQTQLQLMNDLWLALERQELRLVYQPKFQAPAGPIVGFEALLRWYHPKQGVL
NPDQFLPLAEKTGLIVTIGSWVIDEACRQLREWHLQGYDLWSVAVNLSALQFEQPGLVDT
ITRSLARHSIRPDLLILEITETTAMNKPEQSVAILTRLTEMGVKASIDDFGTGYSSLLYL
KRLPACELKIDRAFVHELSEAGDGATIVAAIVALAKALNLQIVAEGVENETQQQFLTQLG
CHTLQGFLLGKPRTAEEIARDIRDPANIFTRSIYNINSK