Protein Info for PS417_01075 in Pseudomonas simiae WCS417

Annotation: N5,N10-methylene tetrahydromethanopterin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 TIGR03860: FMN-dependent oxidoreductase, nitrilotriacetate monooxygenase family" amino acids 8 to 431 (424 residues), 555 bits, see alignment E=5.3e-171 PF00296: Bac_luciferase" amino acids 29 to 389 (361 residues), 188.6 bits, see alignment E=9.3e-60

Best Hits

KEGG orthology group: None (inferred from 97% identity to pfs:PFLU0240)

Predicted SEED Role

"Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TWW2 at UniProt or InterPro

Protein Sequence (450 amino acids)

>PS417_01075 N5,N10-methylene tetrahydromethanopterin reductase (Pseudomonas simiae WCS417)
MSKKKILLNAFNMNCIGHINHGLWTHPRDTSTEYKTIEYWTELAKTLERGLFDGLFIADI
VGVYDVYQNSIDVPLKESIQLPVNDPLLLVSAMAAVTRNLGFGLTANLTYEPPYLFARRM
STLDHLSRGRVGWNIVTGYLDSAAKAMGLTEQVEHDRRYDQADEYLEVLYKLWEGSWEDG
AVLNDPQTRVYAQPGKVHKIEHHGEFYQVEGYHLCEPSPQRTPVLFQAGSSDRGLLFAGR
HAECVFISGQNKAATKVQVDKVRASAVEAGRNPDDIKVFMGLNVIVGATEALAWEKHAEY
LSYASAEAGVAHFSASTAIDFAQYELDEPIQYVKSNAIQSATKNLQNNDWTRRKLLEQHA
LGGRYITLVGSPEQVADELESWISETGLDGFNLTRIVTPESYVDFIDLVVPELQKRGSYK
TAYEHGTLREKVFHGSARLPEQHTGSTYRH