Protein Info for GFF2118 in Sphingobium sp. HT1-2

Annotation: NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 53 to 71 (19 residues), see Phobius details TIGR01957: NADH-quinone oxidoreductase, B subunit" amino acids 37 to 178 (142 residues), 242.3 bits, see alignment E=7.6e-77 PF01058: Oxidored_q6" amino acids 63 to 172 (110 residues), 101 bits, see alignment E=2.1e-33

Best Hits

Swiss-Prot: 90% identical to NUOB_SPHAL: NADH-quinone oxidoreductase subunit B (nuoB) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 95% identity to sch:Sphch_1185)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>GFF2118 NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3) (Sphingobium sp. HT1-2)
LGVELTSPIPGTMPPMGTQPDQDFFNALSSEVSDKGFLVTSTEELFQWARTGSLWWMTFG
LACCAVEMIHVNMPRYDMERFGAAPRASPRQSDVMIVAGTLCNKMAPALRKVYDQMSNPK
YVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGIMQLQRKIRRIG
TIER