Protein Info for GFF2118 in Sphingobium sp. HT1-2

Annotation: NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01957: NADH-quinone oxidoreductase, B subunit
  • amino acids 37 to 178 (142 residues), 242.3 bits, E=7.6e-77
• PF01058: Oxidored_q6
  • amino acids 63 to 172 (110 residues), 101 bits, E=2e-33

Best Hits

Swiss-Prot: 90% identical to NUOB_SPHAL: NADH-quinone oxidoreductase subunit B (nuoB) from Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 95% identity to sch:Sphch_1185)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (184 amino acids)

>GFF2118 NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3) (Sphingobium sp. HT1-2)
LGVELTSPIPGTMPPMGTQPDQDFFNALSSEVSDKGFLVTSTEELFQWARTGSLWWMTFG
LACCAVEMIHVNMPRYDMERFGAAPRASPRQSDVMIVAGTLCNKMAPALRKVYDQMSNPK
YVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPGCPPTAEALLYGIMQLQRKIRRIG
TIER