Protein Info for GFF2117 in Variovorax sp. SCN45

Annotation: no description

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 183 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details PF07963: N_methyl" amino acids 5 to 29 (25 residues), 35 bits, see alignment (E = 7.1e-13) TIGR01708: type II secretion system protein H" amino acids 6 to 71 (66 residues), 48.5 bits, see alignment E=8.3e-17 TIGR02532: prepilin-type N-terminal cleavage/methylation domain" amino acids 7 to 30 (24 residues), 29.7 bits, see alignment (E = 4e-11) PF12019: GspH" amino acids 45 to 170 (126 residues), 77.2 bits, see alignment E=1.3e-25

Best Hits

KEGG orthology group: K08084, type IV fimbrial biogenesis protein FimT (inferred from 54% identity to rso:RS05337)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (183 amino acids)

>GFF2117 no description (Variovorax sp. SCN45)
MNMPRHQTGFTLIELMVVVALVAILTMIAVPSFVSLIQSNRVSTEVNSFAGDLQYARSEA
IRQGVPVSVCASSDSKSCLGTNSWQSGWIVFADPDGSGTFTAGDTLLRTRPAWSSTDTFA
GTPSINVVTYSRDGFANLPVASPTSWIMLALRTAPVNANATRCVSINRVGHQVVLQGGQG
GCA