Protein Info for GFF2115 in Methylophilus sp. DMC18
Annotation: Glucose 1-dehydrogenase 2
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 68% identical to Y182_METEA: Uncharacterized oxidoreductase MexAM1_META1p0182 (MexAM1_META1p0182) from Methylobacterium extorquens (strain ATCC 14718 / DSM 1338 / JCM 2805 / NCIMB 9133 / AM1)
KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 77% identity to gdj:Gdia_2299)Predicted SEED Role
"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)
MetaCyc Pathways
- superpathway of fatty acids biosynthesis (E. coli) (51/53 steps found)
- superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
- palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
- superpathway of unsaturated fatty acids biosynthesis (E. coli) (20/20 steps found)
- superpathway of fatty acid biosynthesis I (E. coli) (16/16 steps found)
- biotin biosynthesis I (14/15 steps found)
- oleate biosynthesis IV (anaerobic) (13/14 steps found)
- palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (9/9 steps found)
- 8-amino-7-oxononanoate biosynthesis I (10/11 steps found)
- (5Z)-dodecenoate biosynthesis I (6/6 steps found)
- cis-vaccenate biosynthesis (5/5 steps found)
- fatty acid elongation -- saturated (5/5 steps found)
- gondoate biosynthesis (anaerobic) (4/4 steps found)
- (5Z)-dodecenoate biosynthesis II (5/6 steps found)
- stearate biosynthesis II (bacteria and plants) (5/6 steps found)
- 8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
- octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
- palmitate biosynthesis III (21/29 steps found)
- stearate biosynthesis IV (4/6 steps found)
- anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
- even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
- tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
- petroselinate biosynthesis (2/6 steps found)
- 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
- streptorubin B biosynthesis (20/34 steps found)
- mycolate biosynthesis (20/205 steps found)
- superpathway of mycolate biosynthesis (21/239 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.100
Use Curated BLAST to search for 1.1.1.100
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (249 amino acids)
>GFF2115 Glucose 1-dehydrogenase 2 (Methylophilus sp. DMC18) MSKKLEGKVAVVTGASKGIGAEIAKRFAREGAAVVVNYLSSKAGADKVVAEITQAGGKAV AVGGNVSEVADAHALVDAAITHFGKLDILVNNSGVYEFATLEEITPDHFHKQFNINVLGL LLTSQAAVKHLPEGGSIINIGSVVSRLTPPASAVYTGTKGAVDAITGVLARELGPRKIRV NALNPGLVETEGTHTAGVIGSEMESAYVAQTPLGRSGQPNDIASVAVFLASEDAYWLTGE QLLVGGGLR