Protein Info for GFF2113 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 13 to 33 (21 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 101 to 120 (20 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 185 to 209 (25 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 253 to 272 (20 residues), see Phobius details amino acids 278 to 295 (18 residues), see Phobius details PF00892: EamA" amino acids 14 to 143 (130 residues), 79.7 bits, see alignment E=1.2e-26 amino acids 157 to 291 (135 residues), 62.3 bits, see alignment E=2.8e-21

Best Hits

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>GFF2113 Permease of the drug/metabolite transporter (DMT) superfamily (Hydrogenophaga sp. GW460-11-11-14-LB1)
VTAAHPAPARLQAMLMLNMLVWGINMPVVKWLTGHFDSLLLAGLRMLAAMLMMCLLLRGR
TVSLNLRREQWVQLLLCALCLIYLNQWLFAEGLRRSTATNGALIAALQPLVAALVAMVLL
RERLGMRRLAGALLGLGGAALAILHRPVAQLVEAGVGDGLVMLAVLVFCLGAVLTQRLVR
EMDAVVLTILVHAIGAAALLGHAGLAWLWSGEPPRAPPAGWLWAGLVVSGLLSAGIGNLL
WTRSISLIGMARASQWLHWVPIFGIATAAVFLGEPITWWHVVGLVLVLAGTRLGLERS