Protein Info for GFF2112 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: 2-keto-4-pentenoate hydratase (EC 4.2.1.80)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01557: FAA_hydrolase
  • amino acids 98 to 254 (157 residues), 43.2 bits, E=2e-15

Best Hits

KEGG orthology group: K01617, 4-oxalocrotonate decarboxylase [EC: 4.1.1.77] (inferred from 34% identity to bpf:BpOF4_12615)

Predicted SEED Role

No annotation

MetaCyc Pathways

• 2-amino-3-carboxymuconate semialdehyde degradation to 2-hydroxypentadienoate (2/4 steps found)
• 3-chlorocatechol degradation III (meta pathway) (2/4 steps found)
• catechol degradation to 2-hydroxypentadienoate II (2/4 steps found)
• orthanilate degradation (2/5 steps found)
• protocatechuate degradation III (para-cleavage pathway) (2/5 steps found)
• 2-aminophenol degradation (1/4 steps found)
• 4-amino-3-hydroxybenzoate degradation (2/6 steps found)
• 2,3-dihydroxybenzoate degradation (1/5 steps found)
• 2-nitrobenzoate degradation I (2/7 steps found)
• catechol degradation II (meta-cleavage pathway) (2/7 steps found)
• L-tryptophan degradation IX (5/12 steps found)
• L-tryptophan degradation XII (Geobacillus) (5/12 steps found)
• meta cleavage pathway of aromatic compounds (3/10 steps found)
• 4-chloronitrobenzene degradation (1/9 steps found)
• 4-nitrotoluene degradation II (1/9 steps found)
• 2,2'-dihydroxybiphenyl degradation (1/10 steps found)
• toluene degradation IV (aerobic) (via catechol) (3/13 steps found)
• superpathway of aerobic toluene degradation (10/30 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation
• Fluorene degradation
• Toluene and xylene degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.77

Protein Sequence (256 amino acids)

>GFF2112 2-keto-4-pentenoate hydratase (EC 4.2.1.80) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MRHEWIEGLRQAARTGVPWAVDPTTLACDLDKAYALQAEHLRQVLAERDDAVVGAKLSVT
SAPALERLGLRAPLIGPILRSRRHTSGATLPRSDFMVCVVEAEVGFRLGRDIEGSLSREE
LLDAIDAVFPAIEVADSRYARWAEAPAPAIVADLAYAGAWVRGADFANWRELDLRALPVR
LHRDGELAREGHSSAVLGDPVEALARALAEAARHGRVLRAGTLVSTGTCTAPWPLDGGGH
LSADFGPLGRVELTLS