Protein Info for GFF211 in Xanthobacter sp. DMC5

Annotation: NADH-quinone oxidoreductase subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF01257: 2Fe-2S_thioredx" amino acids 13 to 153 (141 residues), 150.8 bits, see alignment E=1.3e-48

Best Hits

Swiss-Prot: 36% identical to NUOE_PSEAE: NADH-quinone oxidoreductase subunit E (nuoE) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00127, formate dehydrogenase, gamma subunit [EC: 1.2.1.2] (inferred from 84% identity to xau:Xaut_3481)

MetaCyc: 38% identical to hydrogenase (NAD+, ferredoxin) gamma subunit (Gottschalkia acidurici)

Predicted SEED Role

"NAD-dependent formate dehydrogenase gamma subunit" in subsystem Formate hydrogenase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>GFF211 NADH-quinone oxidoreductase subunit E (Xanthobacter sp. DMC5)
MAVYEDWSTERAAQVIAEHKHLDGATMPILHAMQETFGFVPDPVVPMIAETLNLSRAEVY
GVLTFYHDFRREPPGRTVVKLCAAEACQSMGSTALTAYAEEKLGVSMGETSADGRVTLEP
IYCLGLCACAPSALVDGQLVGRLDRATVDEIAECVAAGKHFGEV