Protein Info for GFF2106 in Variovorax sp. SCN45

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 62 (21 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 99 to 119 (21 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 223 to 384 (162 residues), 150.3 bits, see alignment E=2e-48 PF00990: GGDEF" amino acids 226 to 381 (156 residues), 129.8 bits, see alignment E=4.2e-42

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>GFF2106 hypothetical protein (Variovorax sp. SCN45)
MGALPSFLDPRSVIVLAGLMGVMMALVMFFMRRSYPPSIRGLGDWALAPLVAFASTMLFA
GRDYIPDFLTIVVANVVLFQGCILYYSGSQKFLLGHSDVRGWTLLNGVIGLSMFWFSSIK
PDFEARLLIVTFAVSLLFFSHALLYLRHRPRVFGQRLMIGLLLAQAIVAALRFVSVVMGM
AGSNLMDGNWIQSLYISMYSFSVLLLSISVILMATDRVHTEFEYMATRDSLTGALNRRAL
LDACRGAFASDRRHMALLMVDLDHFKAVNDRFGHQMGDKVLREAVRRMQRAVGDAGVLGR
YGGEEFVVLLPGTGKVEAMAIAARLKQAIGEPFAPDSPMAEVGSIAVSIGVAASDGGRGV
DEVLARADAALYKAKAMGRDQVIAAA