Protein Info for GFF2106 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: L-aspartate oxidase (EC 1.4.3.16)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 540 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR00551: L-aspartate oxidase" amino acids 8 to 520 (513 residues), 772 bits, see alignment E=1.2e-236 PF07992: Pyr_redox_2" amino acids 10 to 210 (201 residues), 26.4 bits, see alignment E=9e-10 PF00890: FAD_binding_2" amino acids 10 to 392 (383 residues), 348.8 bits, see alignment E=1.1e-107 PF01266: DAO" amino acids 10 to 84 (75 residues), 33.2 bits, see alignment E=8.6e-12 PF02910: Succ_DH_flav_C" amino acids 441 to 522 (82 residues), 56.1 bits, see alignment E=7.6e-19

Best Hits

Swiss-Prot: 100% identical to NADB_SALTY: L-aspartate oxidase (nadB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00278, L-aspartate oxidase [EC: 1.4.3.16] (inferred from 99% identity to sec:SC2646)

MetaCyc: 90% identical to L-aspartate oxidase (Escherichia coli K-12 substr. MG1655)
1.5.98.-; L-aspartate oxidase. [EC: 1.4.3.16]

Predicted SEED Role

"L-aspartate oxidase (EC 1.4.3.16)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 1.4.3.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (540 amino acids)

>GFF2106 L-aspartate oxidase (EC 1.4.3.16) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MMTTPELSCDVLIIGSGAAGLSLALRLAEKHKVIVLSKGPVSEGSTFYAQGGIAAVFDET
DSIASHVEDTLIAGAGICDRHAVEFVASNARTCVQWLIDQGVLFDTHVQPNGKESYHLTR
EGGHSHRRILHAADATGKEVETTLVSRAQNHPNIQVLERSNAVDLIISDKMGLPGPRRVV
GAWIWNRNKEWVETCHAKSVVLATGGASKVYQYTTNPDISSGDGIAMAWRAGCRVANLEF
NQFHPTALYHPQARNFLLTEALRGEGAYLKRPDGSRFMPDVDERGELAPRDIVARAIDHE
MKQLGADCMFLDISHKPDDFVRQHFPMIYAKLLDLGMDLTKEPIPVVPAAHYTCGGVVVD
DYGRTDVDGLYAIGEVSYTGLHGANRMASNSLLECLVYGWSAAMDIDRRMPSVHSVDALP
AWDESRVENADERVVIQHNWHELRLLMWDYVGIVRTTKRLERALRRITMLQQEIDEYYAN
FRVSNNLLELRNLVQVAELIVRCAMMRKESRGLHFTLDYPQQLAESGPSILSPLTPHINR