Protein Info for GFF2102 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 39 to 56 (18 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 89 to 106 (18 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 241 to 265 (25 residues), see Phobius details amino acids 272 to 299 (28 residues), see Phobius details amino acids 315 to 339 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 63 to 324 (262 residues), 128.2 bits, see alignment E=1.7e-41

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 61% identity to rfr:Rfer_1004)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>GFF2102 Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAAISENTAARVLPSTPSSHTTPVIAPVAAGGLSRLERTGLVLLLALACALPLLVTDYRL
FQATMTLIYAIVLFGLTILTGYSGQISLGHGAFYALGAYTTAILIARLGVPYWATLPIAG
AVCMVVGFLFGRPALRLQGHYLALATFALAVATPQFLKHKSLQGWTGGVQGITLEKPSAP
FGLPMTPDAWLYLLTLFVAVVMFVLGRNLLKGRIGRALLAIRDHPTAASAMGVNISLYKS
LAFSVSALFTGVAGGLGAIVVQFVAPDSFHPLLSILFLVGAVIGGLSSWWGPLFGAMFIQ
FVPNFAEDLSKSAPWAIYGVLMILSVFLLKKGIAGALEGAWRRLTRSRRHHPIPPSSETP