Protein Info for GFF210 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Carnitine racemase (EC 5.-.-.-) / Carnitinyl-CoA dehydratase (EC 4.2.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 10 to 260 (251 residues), 281.3 bits, E=6.6e-88
• PF16113: ECH_2
  • amino acids 15 to 214 (200 residues), 116.4 bits, E=2.1e-37

Best Hits

Swiss-Prot: 100% identical to CAID_SALSV: Carnitinyl-CoA dehydratase (caiD) from Salmonella schwarzengrund (strain CVM19633)

KEGG orthology group: K08299, carnitinyl-CoA dehydratase [EC: 4.2.1.-] (inferred from 99% identity to set:SEN0071)

MetaCyc: 94% identical to crotonobetainyl-CoA hydratase (Escherichia coli K-12 substr. MG1655)
CARNDETRU-RXN [EC: 4.2.1.149]

Predicted SEED Role

"Carnitine racemase (EC 5.-.-.-) / Carnitinyl-CoA dehydratase (EC 4.2.1.-)" (EC 4.2.1.-, EC 5.-.-.-)

MetaCyc Pathways

• L-carnitine degradation I (5/5 steps found)
• γ-butyrobetaine degradation III (1/4 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 5.-.-.-

Use Curated BLAST to search for 4.2.1.- or 4.2.1.149 or 5.-.-.-

Protein Sequence (261 amino acids)

>GFF210 Carnitine racemase (EC 5.-.-.-) / Carnitinyl-CoA dehydratase (EC 4.2.1.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSESLHLTRNGPILEITLDRPKANAIDAKTSFAMGEAFLNFRDDPELRVAIITGGGEKFF
SAGWDLKAAAEGEAPDADFGPGGFAGLTEIFDLDKPVIAAVNGYAFGGGFELALAADFIV
CAENASFALPEAKLGIVPDSGGVLRLPKLLPPAIVNEMVMTGRRMSAEEALRWGVVNRVV
SQSELMESARELAQQLVNSAPLAIAALKEIYRATSEMPVEEGYRYIRSGVLKHYPSVLHS
EDALEGPQAFAEKRDPVWKGR