Protein Info for GFF2099 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: hypothetical tRNA/rRNA methyltransferase yfiF [EC:2.1.1.-]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF08032: SpoU_sub_bind" amino acids 110 to 181 (72 residues), 54.2 bits, see alignment E=1.5e-18 PF00588: SpoU_methylase" amino acids 199 to 336 (138 residues), 107.8 bits, see alignment E=5e-35

Best Hits

Swiss-Prot: 88% identical to YFIF_ECOLI: Uncharacterized tRNA/rRNA methyltransferase YfiF (yfiF) from Escherichia coli (strain K12)

KEGG orthology group: K03214, RNA methyltransferase, TrmH family [EC: 2.1.1.-] (inferred from 99% identity to spt:SPA0270)

Predicted SEED Role

"hypothetical tRNA/rRNA methyltransferase yfiF [EC:2.1.1.-]"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (345 amino acids)

>GFF2099 hypothetical tRNA/rRNA methyltransferase yfiF [EC:2.1.1.-] (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNDELKNKSGKVKVMYVRSDDDSDKRTHNPRTGKGGGRPAKSRTDGGRRPARDERNNQSR
DRKHETSPWRTVSRAPGDETPEKVDHGGISGKSFIDPEVLRRQRAEETRVYGENACQALF
QSRPDAIVRAWFIQSVTPRFKEALRWMAANRKAYHVVDEAELAKASGTEHHGGVCFLIKK
RNGTTVKQWVKQAADQDCVLALEDVANPHNLGGMMRSCAHFGVKGVVVQDAALLESGAAI
RTAEGGAEHVQPITGESIVDVLDDFRQAGYTVVTTSSDRGQALFSTTLPEKMVLVLGREY
DYLPEAAREPDDLCVKINGTGNVESLNVSVATGVLLAEWWRQNKA