Protein Info for GFF2098 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Thioredoxin 2 (EC 1.8.1.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 PF21352: Zn_ribbon_Thio2" amino acids 4 to 29 (26 residues), 48.5 bits, see alignment 1.8e-16 PF00085: Thioredoxin" amino acids 37 to 136 (100 residues), 95.6 bits, see alignment E=5e-31 PF13098: Thioredoxin_2" amino acids 44 to 138 (95 residues), 46.3 bits, see alignment E=1.5e-15 PF20207: PedC-like" amino acids 44 to 136 (93 residues), 28.7 bits, see alignment E=3.3e-10 TIGR01068: thioredoxin" amino acids 45 to 138 (94 residues), 122.4 bits, see alignment E=3.9e-40

Best Hits

Swiss-Prot: 95% identical to THIO2_ECOLI: Thioredoxin 2 (trxC) from Escherichia coli (strain K12)

KEGG orthology group: K03672, thioredoxin 2 [EC: 1.8.1.8] (inferred from 95% identity to eco:b2582)

MetaCyc: 95% identical to reduced thioredoxin 2 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Thioredoxin 2 (EC 1.8.1.8)" (EC 1.8.1.8)

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>GFF2098 Thioredoxin 2 (EC 1.8.1.8) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNTVCTHCQAINRIPDDRLQDAAKCGRCGHELFDGEVINATGETLDKLLKDDLPVVIDFW
APWCGPCRNFAPIFEDVAEERSGKVRFVKVNTEAERELSARFGIRSIPTIMIFKHGQVVD
MLNGAVPKAPFDSWLNEAL