Protein Info for GFF2096 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Protein acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 886 PF13380: CoA_binding_2" amino acids 13 to 130 (118 residues), 84.6 bits, see alignment E=1.8e-27 PF13607: Succ_CoA_lig" amino acids 147 to 280 (134 residues), 154.5 bits, see alignment E=3.6e-49 PF13549: ATP-grasp_5" amino acids 473 to 693 (221 residues), 245.5 bits, see alignment E=1e-76 PF13302: Acetyltransf_3" amino acids 725 to 864 (140 residues), 38.8 bits, see alignment E=3.7e-13 PF00583: Acetyltransf_1" amino acids 758 to 863 (106 residues), 48.3 bits, see alignment E=2.9e-16

Best Hits

Swiss-Prot: 100% identical to LYSAC_SALTY: Peptidyl-lysine N-acetyltransferase Pat (pat) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K09181, hypothetical protein (inferred from 93% identity to cko:CKO_00200)

MetaCyc: 92% identical to peptidyl-lysine N-acetyltransferase (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

"Protein acetyltransferase" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (886 amino acids)

>GFF2096 Protein acetyltransferase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSQQGLEALLRPKSIAVIGASMKPHRAGYLMMRNLLAGGFNGPVLPVTPAWKAVLGVMAW
PDIASLPFTPDLAILCTNASRNLALLDALGAKGCKTCIILSAPTSQHEELLACARHYKMR
LLGPNSLGLLAPWQGLNASFSPVPIKQGKLAFISQSAAVSNTILDWAQQREMGFSYFIAL
GDSLDIDVDELLDYLARDSKTSAILLYLEQLSDARRFVSAARSASRNKPILVIKSGRSPA
AQRLLNTSAGMDPAWDAAIQRAGLLRVQDTHELFSAVETLSHMRPLRGDRLMIISNGAAP
AALALDELWSRNGKLATLSEETCLQLRQALPAHIDIANPLDLCDDASSEHYVKTLDILLA
SQDFDALMVIHSPSAAAPGTESAHALIETIKRHPRGKFVTLLTNWCGEFSSQEARRLFSE
AGLPTYRTPEGTITAFMHMVEYRRNQKQLRETPALPSNLTSNTAEAHNLLQRAIAEGAAS
LDTHEVQPILHAYGLHTLPTWIASDSAEAVHIAEQIGYPVALKLRSPDIPHKSEVQGVML
YLRTASEVQQAANAIFDRVKMAWPQARIHGLLVQSMANRAGAQELRVVVEHDPVFGPLIM
LGEGGVEWRPEEQAVVALPPLNMNLARYLVIQGIKQRKIRARSALRPLDIVGLSQLLVQV
SNLIVDCPEIQRLDIHPLLASASEFTALDVTLDIAPFDGDNESRLAVRPYPHQLEEWVEM
KNGDRCLFRPILPEDEPQLRQFIAQVTKEDLYYRYFSEINEFTHEDLANMTQIDYDREMA
FVAVRRMDNAEEILGVTRAISDPDNVDAEFAVLVRSDLKGLGLGRRLMEKLIAYTRDHGL
KRLNGITMPNNRGMVALARKLGFQVDIQLEEGIVGLTLNLAKCDES