Protein Info for GFF2095 in Variovorax sp. SCN45

Annotation: Acyl-CoA dehydrogenase, long-chain specific (EC 1.3.8.8)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF02771: Acyl-CoA_dh_N" amino acids 8 to 123 (116 residues), 72.4 bits, see alignment E=6.1e-24 PF02770: Acyl-CoA_dh_M" amino acids 127 to 221 (95 residues), 63.2 bits, see alignment E=3.2e-21 PF00441: Acyl-CoA_dh_1" amino acids 233 to 395 (163 residues), 60.6 bits, see alignment E=3e-20

Best Hits

KEGG orthology group: None (inferred from 53% identity to cse:Cseg_3822)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>GFF2095 Acyl-CoA dehydrogenase, long-chain specific (EC 1.3.8.8) (Variovorax sp. SCN45)
MAWTLSAAETAFRDEVRDFLARELTPELRAAGRRCSGIFSDYEYGNRWHRILAARGWSVP
HWPVEHGGTGWTPMQHYLFASELAAADAPPRAPMGPGMVAPVIIAFGTEAQKRAWLPGIR
SGEDYWCQGYSEPQSGSDLASLQCKAVRDGNDYVINGTKIWTTHAQYANRMFCLVRTASG
GKPQQGISFLCFDIPTPGITIRPIISISGDHELNQVFFDDVRVPAEGLIGEENQGWTIAK
YLLQHERGGAWAPMLRARLRRLGAAADAAFAAGTRNHDEAGDMALRLAEMDCAIDALEAT
ELQSLRAQARGEPHGIRPSMGKVLGSELRQRLTELGVEIAGHYAAASLPLDDGLGGELPI
PEEAVFSMSAYLNDRAASIYAGSNEVQRNIVASHLLAR