Protein Info for GFF2093 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Alpha-ketoglutarate permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 transmembrane" amino acids 22 to 50 (29 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 196 to 215 (20 residues), see Phobius details amino acids 245 to 264 (20 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 313 to 332 (20 residues), see Phobius details amino acids 338 to 361 (24 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 406 to 424 (19 residues), see Phobius details PF00083: Sugar_tr" amino acids 25 to 222 (198 residues), 94.3 bits, see alignment E=1.3e-30 amino acids 229 to 425 (197 residues), 45.5 bits, see alignment E=8.1e-16 TIGR00883: MFS transporter, metabolite:H+ symporter (MHS) family protein" amino acids 31 to 418 (388 residues), 478.5 bits, see alignment E=9e-148 PF07690: MFS_1" amino acids 65 to 384 (320 residues), 94 bits, see alignment E=1.4e-30 PF13347: MFS_2" amino acids 161 to 368 (208 residues), 32 bits, see alignment E=7.8e-12

Best Hits

Swiss-Prot: 91% identical to KGTP_SHIFL: Alpha-ketoglutarate permease (kgtP) from Shigella flexneri

KEGG orthology group: K03761, MFS transporter, MHS family, alpha-ketoglutarate permease (inferred from 99% identity to sty:STY2847)

MetaCyc: 91% identical to alpha-ketoglutarate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-23

Predicted SEED Role

"Alpha-ketoglutarate permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>GFF2093 Alpha-ketoglutarate permease (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MAEIIQRIDKNNAEAPEMRRRIWAIVGASSGNLVEWFDFYVYSFCSLYFAHIFFPSGNTT
TQLLQTAGVFAAGFLMRPIGGWLFGRIADRRGRKASMLISVCMMCMGSLVIACLPGYDTI
GTWAPALLLIARLFQGLSVGGEYGTSATYMSEVALEGRKGFFASFQYVTLIGGQLLALLV
VVILQQVLDDAELRAWGWRIPFALGAVLAVVALWLRRQLDETSKHETRALKEAGSLKGLW
RNRKAFLMVLGFTAAGSLCFYTFTTYMQKYLVNTAGMHANVASGIMTAALCVFMLVQPLF
GALSDKIGRRTSMLCFGALATLFTVPILSALQNVTSPYAAFALVICALLIVSFYTSISGI
LKAEMFPAQVRALGVGLSYAVANALFGGSAEYVALSLKSVGMESSFFWYVTAMAVLAFLV
SLMLHRKGKGLRL