Protein Info for GFF2091 in Variovorax sp. SCN45

Annotation: Cobalt/zinc/cadmium resistance protein CzcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details amino acids 59 to 76 (18 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 126 to 148 (23 residues), see Phobius details amino acids 181 to 205 (25 residues), see Phobius details amino acids 211 to 229 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 23 to 315 (293 residues), 212.7 bits, see alignment E=3.4e-67 PF01545: Cation_efflux" amino acids 29 to 237 (209 residues), 120.4 bits, see alignment E=4.5e-39

Best Hits

KEGG orthology group: None (inferred from 91% identity to vpe:Varpa_5283)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF2091 Cobalt/zinc/cadmium resistance protein CzcD (Variovorax sp. SCN45)
MHTHDLSAWRHDHHFGADNTSAERSTRLVMWITAVMMVVEIGAGWWFNSMALLADGWHMS
SHALAIGLSAFAYAASRRYARDPRFAFGTWKIEVLAGFASALALLGIAVLMMVGSLERLW
SPAAIHYPEAISVAVLGLVVNLVCARLLGGAHHHGHDHGHDHGHHHAHDGHGHDLNLRSA
YIHVVADAATSVLAIAALLGGWFYGWAWLDPAMGIVGAVLVAAWAKGLLKETGKVLLDRE
MDHPVTEEIREGVETLLADSETRVADLHVWRVGREAYACALTVVTHSATLTADQVRACFS
MHEEIRHSTVEIQRCVD