Protein Info for GFF2090 in Xanthobacter sp. DMC5

Annotation: Glycerol-3-phosphate dehydrogenase [NAD(P)+]

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01210: NAD_Gly3P_dh_N
  • amino acids 1 to 149 (149 residues), 136.7 bits, E=1.8e-43
• PF02558: ApbA
  • amino acids 1 to 102 (102 residues), 23.6 bits, E=8.7e-09
• PF03807: F420_oxidored
  • amino acids 2 to 99 (98 residues), 31.4 bits, E=5.9e-11
• PF07479: NAD_Gly3P_dh_C
  • amino acids 171 to 304 (134 residues), 136.8 bits, E=1.6e-43
• PF20618: GPD_NAD_C_bact
  • amino acids 231 to 291 (61 residues), 46.3 bits, E=1.3e-15

Best Hits

Swiss-Prot: 73% identical to GPDA_AZOC5: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 84% identity to xau:Xaut_1156)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (10/13 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• CDP-diacylglycerol biosynthesis III (4/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
• superpathway of phospholipid biosynthesis II (plants) (12/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Protein Sequence (316 amino acids)

>GFF2090 Glycerol-3-phosphate dehydrogenase [NAD(P)+] (Xanthobacter sp. DMC5)
MGAGAWGTALANAAARAGRDVVLWGRDATAMADMAAARENRPDLPGIALDPAVSPVSDLD
LVADCDAVLLVVPAQACREALGHLGARVPAGMPVISCAKGIERGTRAFMSEVIAEALPGA
RPAVLSGPSFATDVAAGLPTAVTLAAGDGALAKDLAQALGSSTLRLYHSTDVRGAEIGGA
AKNVLAIAAGIVSGRRLGASAAAALVARGFAELMRFGAAYGARPETITGLSGLGDLILTT
SGPQSRNFAFGRALGAGEAVAGKLAEGAFTASVLVEMAAAKGVDVPVSAAVDAVLAGRLG
IDGAIEALMARPQRAE