Protein Info for GFF2089 in Variovorax sp. SCN45

Annotation: CDP-alcohol phosphatidyltransferase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 transmembrane" amino acids 21 to 50 (30 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 90 to 133 (44 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details PF01066: CDP-OH_P_transf" amino acids 27 to 181 (155 residues), 40.1 bits, see alignment E=2.5e-14

Best Hits

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 94% identity to vpe:Varpa_5285)

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.8.5

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (207 amino acids)

>GFF2089 CDP-alcohol phosphatidyltransferase family protein (Variovorax sp. SCN45)
VSIYELKPRFQALLRPLVVRLHAMGVTANQVTLAACVVSVVLGLWLFFAAPSLAAFGLIP
LWMFLRMAFNAIDGMLAREHNQQSKLGAFLNELTDVVSDAALYLPFALVAPFSGFWVGTV
IVLAGLSEFAGALGPTVGASRRYDGPLGKSDRAFVFGALGLYVALGWPLPGWTAWLMPLL
AALVAWTTANRIRRALAEAEAGIPARH