Protein Info for GFF2088 in Xanthobacter sp. DMC5

Annotation: Porphobilinogen deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF01379: Porphobil_deam" amino acids 13 to 221 (209 residues), 267.4 bits, see alignment E=7.9e-84 TIGR00212: hydroxymethylbilane synthase" amino acids 13 to 304 (292 residues), 333.2 bits, see alignment E=5.6e-104 PF03900: Porphobil_deamC" amino acids 238 to 304 (67 residues), 58.4 bits, see alignment E=7.4e-20

Best Hits

Swiss-Prot: 59% identical to HEM3_NITWN: Porphobilinogen deaminase (hemC) from Nitrobacter winogradskyi (strain ATCC 25391 / DSM 10237 / CIP 104748 / NCIMB 11846 / Nb-255)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 84% identity to xau:Xaut_1158)

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (314 amino acids)

>GFF2088 Porphobilinogen deaminase (Xanthobacter sp. DMC5)
MSGGKSPVAPPILRIGTRGSPLALWQAHAVQAALAQALNVAPAEVAVEVIRTTGDQIQDR
ALSEAGGKGLFTKELEEALLDGRVDLAVHSAKDVATYLPEGLHLAGYLPRADVRDALILK
SGAGLADLPAGARVGTASLRREAQLRRLRPDLKVELLRGNVHTRLARVRDGDFDGTLLAL
AGLTRLGLAEVASAVLATSEFLPAVGQGAVAIECRVQDPATNAAIAAIACRDTGIALAAE
RAFLTALDGSCRTPIAGLARVEGDQVRLSGLVMTPDGADAAEASGAAPIADAAALGTALG
TELRASAPARALGL