Protein Info for GFF2087 in Variovorax sp. SCN45

Annotation: Ser/Thr and Tyr protein phosphatase (dual specificity)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 signal peptide" amino acids 12 to 13 (2 residues), see Phobius details transmembrane" amino acids 14 to 34 (21 residues), see Phobius details amino acids 55 to 75 (21 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 157 to 176 (20 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 222 to 240 (19 residues), see Phobius details amino acids 245 to 266 (22 residues), see Phobius details amino acids 281 to 299 (19 residues), see Phobius details amino acids 381 to 403 (23 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_5287)

Predicted SEED Role

"Ser/Thr and Tyr protein phosphatase (dual specificity)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>GFF2087 Ser/Thr and Tyr protein phosphatase (dual specificity) (Variovorax sp. SCN45)
MSARLARRPWKRAAAWLVFLGPLFYATYGFANWWATTRAHVPSMAFDWERQIPFWPWTIF
PYWTINAFYALSLFLARGKHTLDRHALRLVTATLVACTCFILWPLHFSFGQPPVDGAPAF
LFNALRGFDQPFNQAPSLHIALAVILWDWYRQFIRPLWARLVLHAWAFAICASVLTTWQH
HFIDIPTGALLGLFCVWLWPLERKVSMPRAWRCTRDPQRWKLAGFYAVGAALFLAAALHG
GGIALWLAWPAASLALVALNYAGFGARGFQMNAHGRMGWAARWLFAPYRLGAALNAWLWT
RKLPASVEVVPGLRLGRRPTHAEWLAAGKPRLVSLCAELQLPPGVPHARCVPLLDLTVPP
TVRLRRAAAVIEGQRGSADGATVWVCCALGFSRSAAAVIAWLGRYGRAGGIARAEDTVRR
ARPQIVLRDAWRMSLEPLTPLQEVPPHDR