Protein Info for PS417_10635 in Pseudomonas simiae WCS417

Annotation: peptidylprolyl isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 114 PF00254: FKBP_C" amino acids 18 to 107 (90 residues), 111.6 bits, see alignment E=9.3e-37

Best Hits

Swiss-Prot: 53% identical to FKBP_DEBHA: FK506-binding protein 1 (FPR1) from Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968)

KEGG orthology group: K01802, peptidylprolyl isomerase [EC: 5.2.1.8] (inferred from 94% identity to pfs:PFLU2176)

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase (EC 5.2.1.8)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7TWN7 at UniProt or InterPro

Protein Sequence (114 amino acids)

>PS417_10635 peptidylprolyl isomerase (Pseudomonas simiae WCS417)
MSTEELRITDIRPGTGKTVVKGALITTQYTGTLEDGTVFDSSWERGKPFQCVIGTGRVIK
GWDLGLMGMQVGGVRTLFVPAHLAYGERSMGAHIKPNSNLRFEIELLEVLTRDD