Protein Info for GFF2083 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 163 to 188 (26 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details amino acids 364 to 387 (24 residues), see Phobius details PF03929: PepSY_TM" amino acids 21 to 389 (369 residues), 183 bits, see alignment E=5.9e-58

Best Hits

KEGG orthology group: None (inferred from 41% identity to nmu:Nmul_A1822)

Predicted SEED Role

"Sulfite reductase [NADPH] flavoprotein alpha-component (EC 1.8.1.2)" in subsystem Cysteine Biosynthesis (EC 1.8.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.2

Use Curated BLAST to search for 1.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>GFF2083 hypothetical protein (Xanthobacter sp. DMC5)
VSPAAKPAPAKRFTLRPGLVWAHRILGLSTALFLVIAGLTGSVLAFHHELDEWLNPSAYR
ATAVGTPLSPDALARAVEAGHPDFRVWHLSLPHEAGEAAEVAALGRTDPATGEPVPIPAD
TFLVDPVSGEVLAARLWGACCFSALKIMPFLYELHHNLSLPGIYGTLLMGGVALLWLVDG
FVGFALTLPRGRPFLTKWRSAFTIKGGSAFRLNIDLHRAAGLWLFVLLIALALSSVAMNL
RQEVVEPVVGLVSKLTPTPFSGGPLAPLRERTHSFDTVLEAGLKEARARGWQEPAGEIFY
SPHYGVFGVAFGDHDDPMDRRWLYFDGATGAFRSASLPGVGTAGDVFIQLQFPIHSGRVF
GLAGRIIIAVMGVVIAGLAITGVAVWWMKRKGRVGRKGKARTAQAGTGKESRPRAKAMPA
E