Protein Info for GFF2081 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ThiJ/PfpI family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 PF01965: DJ-1_PfpI" amino acids 20 to 217 (198 residues), 47.9 bits, see alignment E=6.7e-17

Best Hits

KEGG orthology group: None (inferred from 64% identity to bcj:BCAM2110)

Predicted SEED Role

"ThiJ/PfpI family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>GFF2081 ThiJ/PfpI family protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
VVTNHADYPSRDDKTGLWLTELTHFWDVLQEAGITMDIASPAGGKSPLDERSLSSFYLDD
AARAHLRDPAFMERLQHTLRAADLDPSNYSAIYFTGGHGTMWDFRDAPDLKQLSEDIYSQ
GGIVSAVCHGNAALVQLRGSDGQPLIAGRRVTGFSNFEERLAGVRDQVPFLLQDALVAAG
AKYEKAWIPFTSFALTDGRIVTGQNPQSGKAVGLQVLTLLRAQQSISDNK