Protein Info for GFF208 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Crotonobetainyl-CoA:carnitine CoA-transferase (EC 2.8.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 PF02515: CoA_transf_3" amino acids 30 to 396 (367 residues), 264.3 bits, see alignment E=9.7e-83

Best Hits

Swiss-Prot: 100% identical to CAIB_SALTY: L-carnitine CoA-transferase (caiB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K08298, crotonobetainyl-CoA:carnitine CoA-transferase [EC: 2.8.3.-] (inferred from 100% identity to seh:SeHA_C0076)

MetaCyc: 95% identical to gamma-butyrobetainyl-CoA:carnitine CoA transferase (Escherichia coli K-12 substr. MG1655)
RXN0-3601 [EC: 2.8.3.21]

Predicted SEED Role

"Crotonobetainyl-CoA:carnitine CoA-transferase (EC 2.8.3.-)" (EC 2.8.3.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.3.- or 2.8.3.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>GFF208 Crotonobetainyl-CoA:carnitine CoA-transferase (EC 2.8.3.-) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MALCLSGLHTAKNARRKMMNHLPMPTFGPLAGVRVVFSGIEIAGPFAGQMFAEWGAEVIW
IENVAWADTIRVQPNYPQLSRRNLHALSLNIFKDEGREAFLKLMETTDIFIEASKGPAFA
RRGITDEVLWEHNPKLVIAHLSGFGQYGTEEYTNLPAYNTIAQAFSGYLIQNGDVDQPMP
AFPYTADYFSGMTATTAALAALHKVRETGKGESIDIAMYEVMLRMGQYFMMDYFNGGEIC
PRMTKGKDPYYAGCGLYKCADGYIVMELVGITQINECFKDIGLAHILGTPEVPEGTQLIH
RVECPYGPLVEEKLDAWLATHTIADVQARFAELNIACAKVLTIPELEGNPQYVARESITQ
WQTMDGRTCKGPNIMPKFKNNPGKIWRGMPSHGMDTAAILKNIGYSEADIKELVGKGLAK
VED