Protein Info for GFF207 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Nucleoside ABC transporter, permease protein 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 61 to 84 (24 residues), see Phobius details amino acids 91 to 111 (21 residues), see Phobius details amino acids 141 to 158 (18 residues), see Phobius details amino acids 186 to 206 (21 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 239 to 259 (21 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 264 (257 residues), 115.6 bits, see alignment E=1.1e-37

Best Hits

Swiss-Prot: 44% identical to TSGCD_HALVD: Putative glucose ABC transporter permease protein TsgC13 (tsgC13) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 88% identity to pna:Pnap_1038)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>GFF207 Nucleoside ABC transporter, permease protein 2 (Hydrogenophaga sp. GW460-11-11-14-LB1)
MESIALLIAASLNAGTVLAIASLGLLINEKAGIVNLGAEGMMLCAALAGFATVIHTGSTT
LGFVAGMAAGALLAAIFGGLVIWLNTNQYATGLALSLFGAGFSAFAGTGYVQEKLPEQTR
HAIPLLGDIPLIGPALFRHHPMVYICVALVIGLIWFLYRTRAGLVLRSVGESPESSHALG
YPVRRIRLVAVMAGGALCGLAGAYVSTVYTPLWVEGMIAGKGWIALALTTFATWRPARVL
LGAYLFGGVTMLQFHLQGIGVNVPSQFLTMMPYVATIVVLVLISRNPTWIRINMPSSIGK
PFYPGA