Protein Info for GFF2069 in Variovorax sp. SCN45

Annotation: Cobalt-zinc-cadmium resistance protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details amino acids 42 to 59 (18 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 110 to 133 (24 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 9 to 288 (280 residues), 212.6 bits, see alignment E=3.5e-67 PF01545: Cation_efflux" amino acids 10 to 203 (194 residues), 160.7 bits, see alignment E=4e-51 PF16916: ZT_dimer" amino acids 233 to 289 (57 residues), 43.3 bits, see alignment E=2.9e-15

Best Hits

KEGG orthology group: None (inferred from 90% identity to vpe:Varpa_5297)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (305 amino acids)

>GFF2069 Cobalt-zinc-cadmium resistance protein (Variovorax sp. SCN45)
MTLTPKTLLRVSVAVALITIVLKGTAGYITNSMGLISDAMESFVNLASAMFALAMVTIAE
RPADDEHPYGHHKAEYFSSGFEGILIVGAAIAILWVSVQRLLSPQPLEQLGWGLALSVVS
SGFNAALAVVLFRAARTHRSIALEADGRHLMTDVWTSAAVVIGIIGVQLSGWLWLDPVLA
IGVALNIVREGAKLVWRSSQGLMDQALDPETLATVRATLDAFAARMPEGTRLRFDDMVTR
SAGQRRFADLHMHVPGDWTLQHAAAMRDQLEQSLMDAVPGLRVTIQLLPLTMEARATQAG
EHHPL