Protein Info for PS417_10540 in Pseudomonas simiae WCS417

Annotation: NAD-dependent deacetylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 72% identical to NPD3_PSESM: NAD-dependent protein deacetylase 3 (cobB3) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 92% identity to pfs:PFLU2155)

Predicted SEED Role

"NAD-dependent protein deacetylase of SIR2 family" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Redox-dependent regulation of nucleus processes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U2D3 at UniProt or InterPro

Protein Sequence (281 amino acids)

>PS417_10540 NAD-dependent deacetylase (Pseudomonas simiae WCS417)
MLDTLEHTEEHLDTLYRALAERRFLVLTGAGISTSSGIPDYRDSEGVRRGKAPMMYQEFL
ATPQARRRYWARAMLGWPRVRIAQPNKAHLALAALQQRERISGLITQNVDTLHDQAGSHD
VIELHGSLHRVLCLDCQLRSQRDAIQRQMEIDNPYLAHVHAVQAPDGDTLLDPAFEEHFQ
VPRCPHCNGERLKPDVVFFGENVAPATAARAMNAVEHAEGLLVVGSSLMAYSAFRLCKAM
VEQSKPVIAINLGKTRGDELLHVKIQASCERLLPLLTDRLR