Protein Info for GFF2062 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 12 to 42 (31 residues), see Phobius details amino acids 57 to 80 (24 residues), see Phobius details amino acids 92 to 137 (46 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details amino acids 182 to 206 (25 residues), see Phobius details amino acids 226 to 253 (28 residues), see Phobius details amino acids 258 to 276 (19 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 332 to 360 (29 residues), see Phobius details amino acids 371 to 391 (21 residues), see Phobius details amino acids 411 to 432 (22 residues), see Phobius details PF06808: DctM" amino acids 12 to 434 (423 residues), 292.3 bits, see alignment E=3e-91 TIGR00786: TRAP transporter, DctM subunit" amino acids 22 to 438 (417 residues), 295.5 bits, see alignment E=2.8e-92

Best Hits

KEGG orthology group: None (inferred from 69% identity to rlt:Rleg2_3373)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>GFF2062 TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6 (Hydrogenophaga sp. GW460-11-11-14-LB1)
MFEFGFMPPLMFAVMVVFLLIGFPVAFSLAAIGLMFGAIGVWMGQFDVSFLHALPLRFHA
IVANDLLWSIPFFTMMGAVLERCRLAEDLLEGVGKLFGAVPGGVAFAVVLVGAVLGAITG
TVAASVVAMGVISLPVMMRYGYNMRLATGVIAASGTITQLIPPSLVLIVLADQLGRSVGD
MYLGAIGPSILQVGVFLLFIAVVAIFRPHHMPPLPAEVRSGPKWKLVGQVLMGMLPAAGL
MFLVLGTILAGWATPTESGAMGAVGAMLLAALNRRLTLDTLWSACKSTMRITTMVIFILM
GSTIFTLVFHGMDGGHWVEHLLTSLPGGQTGFLLFVAAFIFVLAFFLDFFEIAFILIPLL
APAAKALGIDMVWFGVLVCVVMQTSFMHPPFGVALYYIRGIAPPSVKSSDIYLGAIPWIL
LQLVVVVVVVLWPQSVTYWHVEDKKLDAEVIEQKLDSIAIPVYE