Protein Info for GFF206 in Xanthobacter sp. DMC5

Annotation: Cadmium, cobalt and zinc/H(+)-K(+) antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 44 to 69 (26 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 146 to 167 (22 residues), see Phobius details amino acids 180 to 205 (26 residues), see Phobius details amino acids 211 to 228 (18 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 43 to 314 (272 residues), 249.1 bits, see alignment E=2.7e-78 PF01545: Cation_efflux" amino acids 48 to 232 (185 residues), 139.4 bits, see alignment E=1.4e-44 PF16916: ZT_dimer" amino acids 242 to 314 (73 residues), 39.9 bits, see alignment E=3.5e-14

Best Hits

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 79% identity to xau:Xaut_3476)

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>GFF206 Cadmium, cobalt and zinc/H(+)-K(+) antiporter (Xanthobacter sp. DMC5)
MASLQSGHGHDHDDHDSHDQDHAGHSHGPGGHGHSHAPPDSLRAFAIGAGLNLGFVIVEA
GFGFMSGSLALLADAGHNLSDVLGLLLAWGAAWLSRRAPTPKRTYGYGRSSILAALANAT
LLLVATGGIILEAFGRIADPEPIQTGIVMVVALVGVGVNIGTALLFMAGRKGDLNVRGAF
VHMVADGAISLGVVIAGAVIALTGWLWLDPVVSLAISVAIVAGTWGLLRDSVNLAMDMVP
AGVNAAEVEAYLAARPGVSEVHDLHIWGLSTTSVALSAHLVRPGATLDDDFLSETCAELK
ARFGIAHPVLQVEEGRMECALAPRDVV