Protein Info for GFF206 in Variovorax sp. SCN45

Annotation: GMP synthase [glutamine-hydrolyzing], amidotransferase subunit (EC 6.3.5.2) / GMP synthase [glutamine-hydrolyzing], ATP pyrophosphatase subunit (EC 6.3.5.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 6 to 204 (199 residues), 225 bits, E=5.2e-71
• PF00117: GATase
  • amino acids 7 to 199 (193 residues), 126.1 bits, E=3.6e-40
• PF07722: Peptidase_C26
  • amino acids 73 to 183 (111 residues), 31.9 bits, E=2.9e-11
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 214 to 538 (325 residues), 469.8 bits, E=4.1e-145
• PF02540: NAD_synthase
  • amino acids 216 to 254 (39 residues), 28.4 bits, 2.2e-10
• PF00958: GMP_synt_C
  • amino acids 452 to 537 (86 residues), 140.8 bits, E=2.9e-45

Best Hits

Swiss-Prot: 85% identical to GUAA_RHOFT: GMP synthase [glutamine-hydrolyzing] (guaA) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 98% identity to vpe:Varpa_2866)

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (43/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• L-glutamate and L-glutamine biosynthesis (7/7 steps found)
• superpathway of purine nucleotide salvage (12/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (538 amino acids)

>GFF206 GMP synthase [glutamine-hydrolyzing], amidotransferase subunit (EC 6.3.5.2) / GMP synthase [glutamine-hydrolyzing], ATP pyrophosphatase subunit (EC 6.3.5.2) (Variovorax sp. SCN45)
MQHDKILILDFGSQVTQLIARRVREAHVLSEVHPCDVTDEWVREYAADGHLKGVILSGSH
ASVYEETTDKAPQAVFDLGVPVLGICYGMQTMAHQLGGKVEGGHKREFGFAAVRAHGHTA
LLKDIADFTTPEGHGMLNVWMSHGDKVTELPPGFKLMASTDSCPIAGMADEARRYYALQF
HPEVTHTVQGKAIIERFVLGICGAKPDWVMRDHIAEAVQKIREQVGDEEVILGLSGGVDS
SVAAALIHRAIGDQLTCVFVDHGLLRLNEGDMVMEMFEGKLHAKVIRVDASELFLGKLAG
VSDPEAKRKIIGGEFVTVFKQEAAKLKAGDGGHKGATFLAQGTIYPDVIESGGAKSKKAV
TIKSHHNVGGLPEQLGLKLLEPLRDLFKDEVRELGVALGLPPEMVYRHPFPGPGLGVRIL
GEVKKEYADLLRRADAIFIEELRNFTDESGKTWYDLTSQAFTVFLPVKSVGVMGDGRTYD
YVVALRAVQTSDFMTADWAELPYALLKKVSGRIINEVRGINRVTYDVSSKPPATIEWE