Protein Info for GFF2059 in Xanthobacter sp. DMC5

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 111 to 133 (23 residues), see Phobius details amino acids 151 to 167 (17 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 198 to 219 (22 residues), see Phobius details

Best Hits

KEGG orthology group: K12140, hydrogenase-4 component E [EC: 1.-.-.-] (inferred from 88% identity to xau:Xaut_0168)

Predicted SEED Role

"Hydrogenase-4 component E"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>GFF2059 hypothetical protein (Xanthobacter sp. DMC5)
MDRTLEIAHGTPLDAALSASLVFDVAHLFAGALVLISFLMLYQDRLYALLKVFALQAVVL
SLSVGWQALAQDAPHLYVTAAIALVFKAVVIPLALARMVARLGIHRQVETVVSIGPTMLA
GIALVALSLVVMLKATAAVGGAADALAREDLAFALSVVLLGLLMMVTRRNAVSQVIGFMS
LENGLILAATGAKGMPLVVEISVAFSVLIALIVIGIFLFRIRERFDTVDVDALDRFRGGR
A