Protein Info for PS417_10500 in Pseudomonas simiae WCS417

Annotation: lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07759: DUF1615" amino acids 47 to 361 (315 residues), 512.7 bits, see alignment E=1.9e-158

Best Hits

Swiss-Prot: 58% identical to YAIW_ECOLI: Uncharacterized protein YaiW (yaiW) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to pfs:PFLU2148)

Predicted SEED Role

"Putative outer membrane lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U816 at UniProt or InterPro

Protein Sequence (361 amino acids)

>PS417_10500 lipoprotein (Pseudomonas simiae WCS417)
MYSSRLFLCLATLLVLAGCSTTRNPQQPERSEAEVKAQIARLLPAQVPDRKGWAEDIYTA
FDTQKIYPSTENICAVLAVTEQESTFQVDPPVPNMGKIAQDEILRRAGKVHVPAFVVRSA
LQLRSPTGKTYADRLSAARTEKDLSAIFDDFISMVPLGNTLFGGFNPVHTAGPMQVSIDF
AQKQARGYPYTVDGTIRREVFTRRGGMYFGIAHLLGYPVNYDQPLYRFADFNAGWYASRN
AAFQAAVSRAAGKELALDGDLIRYGSLLPGTTELAVRSLGAKLDMRNPSIRSQLEQGEQL
DFEDTTLYKRVFALADKAAGKPMPRAILPGIALKSPKITRNLTTAWFAKRVDERYQRCLK
R