Protein Info for GFF2054 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Cu(I)-responsive transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 TIGR02044: Cu(I)-responsive transcriptional regulator" amino acids 28 to 152 (125 residues), 157.8 bits, see alignment E=6.7e-51 PF00376: MerR" amino acids 28 to 65 (38 residues), 53.4 bits, see alignment 2.8e-18 PF13411: MerR_1" amino acids 28 to 93 (66 residues), 58.5 bits, see alignment E=8.4e-20 PF09278: MerR-DNA-bind" amino acids 70 to 134 (65 residues), 70.2 bits, see alignment E=2.8e-23

Best Hits

Predicted SEED Role

"Cu(I)-responsive transcriptional regulator" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>GFF2054 Cu(I)-responsive transcriptional regulator (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPADRLLHTLASTGEPDPGDALIRWPVSIGKAAQLSGISPKMLRHYESLGLLAAVPRTDS
NYRQYSLADVHTLRFIRRARDMGFSLDAITELVSLWHNRRRSSASVKRITQKHLDELAER
IEALQAMQRTLGQLLHLCPGDDRPDCPILDDLSHPACTVAAKSSTKLYKPATSAARGGNT
RARH