Protein Info for GFF2052 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 239 PF00117: GATase" amino acids 42 to 184 (143 residues), 55.4 bits, see alignment E=3.4e-19

Best Hits

Swiss-Prot: 100% identical to YFEJ_SALTY: Putative glutamine amidotransferase-like protein YfeJ (yfeJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 98% identity to sew:SeSA_A2673)

MetaCyc: 100% identical to gamma-L-glutamyl hydroxamate hydrolase (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-43

Predicted SEED Role

"Putative amidotransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (239 amino acids)

>GFF2052 Putative amidotransferase (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VRVHFVVHESFESAGAYLKWAEDRGYTISWSRVYAGEALPPNADEFDMLVVFGGPQSPRT
TREECPYFDSRAEQHLINQAVTARRMVIGICLGSQLIGEALGAAVCQSPEKEIGHYPITL
TEAGLRHPLIAHFGSPLTVGHWHNDMPGLTDQATVLAESEGCPRQIVQYGNFVYGFQCHM
EFTVEAVEGLIQHSQQELADAQGKRFIRSVAEMRAWNYQQMNEKLWRFLDELTLAHSQK