Protein Info for GFF2050 in Xanthobacter sp. DMC5

Annotation: N-acetylmuramate alpha-1-phosphate uridylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF12804: NTP_transf_3" amino acids 27 to 156 (130 residues), 49 bits, see alignment E=7.9e-17 PF00483: NTP_transferase" amino acids 27 to 145 (119 residues), 58.7 bits, see alignment E=6.8e-20

Best Hits

Swiss-Prot: 51% identical to MURU_CAUVC: N-acetylmuramate alpha-1-phosphate uridylyltransferase (murU) from Caulobacter vibrioides (strain ATCC 19089 / CB15)

KEGG orthology group: None (inferred from 82% identity to xau:Xaut_3298)

Predicted SEED Role

"FIG006611: nucleotidyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>GFF2050 N-acetylmuramate alpha-1-phosphate uridylyltransferase (Xanthobacter sp. DMC5)
VTAAPDTLLDAPAAGTVRIDTARITTAMVLAAGLGTRMRPLTDTRPKPLVEVEGRPLVDH
VLDRVVAAGIPRAIVNLHHHADMLEAHLKARAGAPDILLSDERRVLLETGGGVRKALPLI
GETPFLVINSDTIWIEGARPNLVRLMEQFDPERMDALLLLASAAHSIGYDGMGDFQMDKL
GHLERRGERTIAPFVYAGAAILKPELFDGTPEGAFSLNRVFDRAGAAERLYGLRLDGIWM
HVGTPDAIALAEDAIERSSD