Protein Info for GFF2047 in Xanthobacter sp. DMC5

Annotation: Thioredoxin C-1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00085: Thioredoxin
  • amino acids 3 to 103 (101 residues), 119.5 bits, E=8.7e-39
• TIGR01068: thioredoxin
  • amino acids 7 to 104 (98 residues), 139.9 bits, E=1.4e-45
• PF13098: Thioredoxin_2
  • amino acids 17 to 102 (86 residues), 37.5 bits, E=3.9e-13
• PF13905: Thioredoxin_8
  • amino acids 21 to 66 (46 residues), 28.8 bits, E=1.9e-10

Best Hits

Swiss-Prot: 58% identical to THIO1_CORNE: Thioredoxin C-1 from Corynebacterium nephridii

KEGG orthology group: K03671, thioredoxin 1 (inferred from 93% identity to xau:Xaut_3301)

MetaCyc: 52% identical to reduced thioredoxin 1 (Escherichia coli K-12 substr. MG1655)
RXN-20161 [EC: 1.8.4.16]

Predicted SEED Role

"FIG149041: Thioredoxin"

MetaCyc Pathways

• periplasmic disulfide bond reduction (1/2 steps found)
• cytochrome c biogenesis (system I type) (2/11 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.16

Protein Sequence (106 amino acids)

>GFF2047 Thioredoxin C-1 (Xanthobacter sp. DMC5)
MAVEKVSDQNFDQDVLKSSAPVIVDFWAEWCGPCRMVAPILEEVSGELGEKVRIVKLNVD
ENPQTASKYGIMSIPTLLLFKDGKIASRQVGAAPKAKLVQWINGSI