Protein Info for GFF2045 in Xanthobacter sp. DMC5

Annotation: tRNA pseudouridine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 TIGR00071: tRNA pseudouridine(38-40) synthase" amino acids 5 to 240 (236 residues), 197.8 bits, see alignment E=1e-62 PF01416: PseudoU_synth_1" amino acids 8 to 104 (97 residues), 39.8 bits, see alignment E=2.8e-14 amino acids 144 to 245 (102 residues), 104.1 bits, see alignment E=3e-34

Best Hits

Swiss-Prot: 91% identical to TRUA_XANP2: tRNA pseudouridine synthase A (truA) from Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2)

KEGG orthology group: K06173, tRNA pseudouridine synthase A [EC: 5.4.99.12] (inferred from 91% identity to xau:Xaut_3303)

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (245 amino acids)

>GFF2045 tRNA pseudouridine synthase A (Xanthobacter sp. DMC5)
MPRYKLTIEYDGTPFAGWQMQADLPTVQGVLAEAFQRFCGEKVTVAGAGRTDAGVHATGQ
VAHVDLAKEWRTDTVRDAMTAQLRPHPVAVLSAERVPDSFDARFSATKRHYLYRIVNRRP
DLALDRDRAWRIPQKLDAEAMHAAAQRLLGKHDFSTFRAAECQAASPVKTLDQLDVSRHG
DEIRVVTSARSFLHHQVRSMVGSLMRVGEGRWSADDLAAALAAADRTRCGPMAPAAGLYL
AAVSY