Protein Info for GFF2045 in Variovorax sp. SCN45

Annotation: Peptide chain release factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 542 TIGR00503: peptide chain release factor 3" amino acids 4 to 533 (530 residues), 664.2 bits, see alignment E=1.2e-203 PF00009: GTP_EFTU" amino acids 9 to 274 (266 residues), 181.2 bits, see alignment E=4e-57 PF01926: MMR_HSR1" amino acids 13 to 140 (128 residues), 30.1 bits, see alignment E=1.2e-10 TIGR00231: small GTP-binding protein domain" amino acids 14 to 145 (132 residues), 80.8 bits, see alignment E=1e-26 PF22042: EF-G_D2" amino acids 300 to 385 (86 residues), 72.8 bits, see alignment E=5e-24 PF03144: GTP_EFTU_D2" amino acids 318 to 384 (67 residues), 41.7 bits, see alignment E=3.3e-14 PF16658: RF3_C" amino acids 391 to 518 (128 residues), 143.4 bits, see alignment E=8.9e-46

Best Hits

Swiss-Prot: 59% identical to RF3_CHRVO: Peptide chain release factor 3 (prfC) from Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757)

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 98% identity to vpe:Varpa_5319)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (542 amino acids)

>GFF2045 Peptide chain release factor 3 (Variovorax sp. SCN45)
LSFVAETRRRRTFAIISHPDAGKTTLTEKLLLFSGAIQIAGSVKARKASRHATSDWMEIE
KQRGISVASSVMQMLYRDHVINLLDTPGHKDFSEDTYRVLTAVDSALMVIDAANGVEAQT
RRLIEVCRQRDTPIITFVNKMDREVREPLDILDEVERELGMPCVPMTWPVGQGKTFRGIM
NLRTQAMTVFESGSERLPQDFETIPLSERETLTKRFGADFETAMESMELATGASPAWDRE
AFLAGKQTPVFFGSGVNNFGVMEVLDALVDLAPSPQSRTSTTLVNRQPVVKEIQPEDKDF
AGVVFKVQANMDANHRDRIAFVRMASGKYTPGMKLKVQRTSKELRPTSVVTFMSQRREAV
EEAYAGDIVGFTTHGGVQLGDTITDGASLQFTGLPFFAPELFMTVILKNPLRTKQLQQGL
AQLGEEGAIQVFRPEVGGPMLLGAVGQLQFEVVQHRLKAEYDADVRLEGCQYTGARWITA
DTPAELREFVNAYPVRMAKDAADTLAFLCTSPYDVRLAQERFPKIHFHPLREHAGLALQS
AG