Protein Info for GFF2044 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Agmatinase (EC 3.5.3.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K01480, agmatinase [EC: 3.5.3.11] (inferred from 81% identity to rfr:Rfer_0346)

Predicted SEED Role

"Agmatinase (EC 3.5.3.11)" in subsystem Arginine and Ornithine Degradation or Polyamine Metabolism (EC 3.5.3.11)

MetaCyc Pathways

superpathway of arginine and polyamine biosynthesis (15/17 steps found)
superpathway of putrescine biosynthesis (4/4 steps found)
L-arginine degradation III (arginine decarboxylase/agmatinase pathway) (2/2 steps found)
putrescine biosynthesis I (2/2 steps found)
superpathway of polyamine biosynthesis I (6/8 steps found)
superpathway of L-arginine and L-ornithine degradation (8/13 steps found)
superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (6/11 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>GFF2044 Agmatinase (EC 3.5.3.11) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAMGQFAYANNTNRFLACAPLADQPFAVAGVPFDGVVTNRPGARFGPQAIRAASLMLCDG
IHPVFDVSPVAHLGDALDMRLPNASPLPEVRRHIEEQAAALMAKHHCVFLGGDHSVTLSL
LRAAKARHGGEPLALVHFDAHCDTWVDHFGEPSGHGTWTYEALQEGLASPAHTVQIGIRS
SGERAAREYVADQGGQIFTARALRGLDGAGLQPAIDAIRARIGQRPCYLTLDIDCLDPAF
APGTGTPEPGGMTSSQVLTFLEALADLNWVGMDCVEVAPAYDHAELTTNAAATFVWTYLS
GQVAKRQRGA