Protein Info for GFF2043 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glycine/D-amino acid oxidase (deaminating) in putrescine utilization cluster

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 433 PF01946: Thi4" amino acids 29 to 79 (51 residues), 32.3 bits, see alignment 1.5e-11 PF01494: FAD_binding_3" amino acids 34 to 67 (34 residues), 24.3 bits, see alignment 4.3e-09 PF00890: FAD_binding_2" amino acids 36 to 219 (184 residues), 36.5 bits, see alignment E=8.7e-13 PF01266: DAO" amino acids 36 to 389 (354 residues), 237.2 bits, see alignment E=1e-73 PF13450: NAD_binding_8" amino acids 39 to 72 (34 residues), 27.9 bits, see alignment 5.7e-10

Best Hits

KEGG orthology group: K09471, gamma-glutamylputrescine oxidase [EC: 1.4.3.-] (inferred from 72% identity to vei:Veis_0826)

Predicted SEED Role

"Glycine/D-amino acid oxidase (deaminating) in putrescine utilization cluster"

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (433 amino acids)

>GFF2043 Glycine/D-amino acid oxidase (deaminating) in putrescine utilization cluster (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSLIGSDTQLNQKSYYEASVQRPEALPPLEENIDADVVVVGAGFSGLSAALELAQRGLSV
VVLEADRIGSGASGRNGGQAIVGYASGQGPFEQQLGAEDAKRAWDMSLEALDLIDARIAR
YGIECDRVNGYVYVADSARKAQELHEEMEGLKRRGIAVDWAEGADLPRLINSPRYVAAAR
EQRSGHLHPLKYALGLARAAQAAGVRIFEHSPVTGLQRGATLVASTGRGQVKARFGVLAG
NCMLPEYGPRVAPEIAPRIMPVGTYIVGTAPLDPELCARLIPRNAAVCDNNFVLDYFRFS
ADSRLLFGGRVSYTTRTPANLEALMRQRMGEVFPALREVPIEHLWGGFVDISMNRAPDFG
RLGDNLYYLQGFSGHGVALTGLAGQLVAEAVAGQAGRFDVYARLKHRRFPGGALLRTPSL
ALGMLWHRLRDVI