Protein Info for GFF204 in Pseudomonas sp. DMC3

Annotation: Aspartate carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 19 to 163 (145 residues), 147.6 bits, E=2.9e-47
• TIGR00670: aspartate carbamoyltransferase
  • amino acids 19 to 319 (301 residues), 298.4 bits, E=2.7e-93
• PF00185: OTCace
  • amino acids 171 to 317 (147 residues), 84.1 bits, E=1.1e-27

Best Hits

Swiss-Prot: 100% identical to PYRB_PSEPF: Aspartate carbamoyltransferase (pyrB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 100% identity to pfo:Pfl01_5314)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (9/9 steps found)
• UMP biosynthesis I (6/6 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Protein Sequence (334 amino acids)

>GFF204 Aspartate carbamoyltransferase (Pseudomonas sp. DMC3)
MTPLDTKRPLQLNDQGQLRHFLSLDGLRRELLTEILDTADSFLEVGARAVKKVPLLRGKT
VCNVFFENSTRTRTTFELAAQRLSADVITLNVSTSSASKGETLLDTLRNLEAMAADMFVV
RHGDSGAAHFIAEHVCPQVAIINGGDGRHAHPTQGMLDMLTIRRHKGGFENLSVAIVGDI
LHSRVARSNMLALKTLGCPDIRVIAPKTLLPIGIEQYGVKVYTDMAEGLKDVDVVIMLRL
QRERMTGGLLPSEGEFYRLFGLTTARLAGAKPDCIVMHPGPINRGVEIESAVADGPHSVI
LNQVTYGIAIRMAVLSMAMSGQTAQRQFEQENAQ