Protein Info for PS417_10400 in Pseudomonas simiae WCS417

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 transmembrane" amino acids 12 to 43 (32 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 239 to 260 (22 residues), see Phobius details amino acids 266 to 290 (25 residues), see Phobius details amino acids 310 to 342 (33 residues), see Phobius details PF01594: AI-2E_transport" amino acids 16 to 337 (322 residues), 172 bits, see alignment E=1.1e-54

Best Hits

KEGG orthology group: None (inferred from 99% identity to pfs:PFLU2129)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U7Y8 at UniProt or InterPro

Protein Sequence (355 amino acids)

>PS417_10400 membrane protein (Pseudomonas simiae WCS417)
MNQTNLQFKTLLLLLGLVTIAFIWILLPFYGAVFWAVILGIIFAPMQRRLQQRFGWNRNL
TSLATLSACLIIAILPVIITSALLVQEGATLYKNIESGKLDVAGYIEQFKNVLPPYFQHL
LDRFGMGNLEGLREKIVKSAMQGSQFFATQAFSFGQGTFDFLVSFFIMLYLLYFLLRDGP
ELVRKVRTAVPLAEPQKRRLQLKFNRVVRATVKGNVLVAVTQGALGGLIFWFLDIPSALL
WAVLMAFLSLLPAVGAGIVWGPVAAYFLLSGAIWQGVVLALFGVFVIGLVDNVLRPILVG
KDTKMPDYLILISTLGGLSVFGLNGFVIGPLVAALFMSSWALFVESKPRVKLPLP