Protein Info for GFF2034 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Putrescine transport ATP-binding protein PotG (TC 3.A.1.11.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF00005: ABC_tran" amino acids 24 to 165 (142 residues), 130.3 bits, see alignment E=7.7e-42 TIGR01187: polyamine ABC transporter, ATP-binding protein" amino acids 38 to 362 (325 residues), 409 bits, see alignment E=6.7e-127 PF08402: TOBE_2" amino acids 281 to 362 (82 residues), 56.3 bits, see alignment E=2.9e-19

Best Hits

KEGG orthology group: K11076, putrescine transport system ATP-binding protein (inferred from 87% identity to pna:Pnap_2861)

Predicted SEED Role

"Putrescine transport ATP-binding protein PotG (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (364 amino acids)

>GFF2034 Putrescine transport ATP-binding protein PotG (TC 3.A.1.11.2) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MADTTGFLVTEKLVKRFDEAVAVDEVSLSIGKGEIFALLGSSGCGKSTLLRMLAGFEKPT
SGRILLGGQDVAAMPPYDRPVNMMFQSYALFPHLDIWENVAFGLKREGLPKAEVQQRTDE
MLGLVQLTPYAKRKPHQLSGGQQQRVALARSLAKRPKLLLLDEPLGALDKKLREQTQFEL
VNIIEKVGVTVVMVTHDQEEAMTMASRIAIMSKGRVLQVGSPEEIYEHPANRFVADFIGN
VNLFEGRLSVDETDRCAATTGIGEIHVGHGVSGTLNMPVAIAVRPEKIEISKRRPDDAGP
NVFTGKVKEIAYFGSYNTYIVLATDGTKVKVTEANTSRHDLSDITWEDDVYFWWDDRAGV
VLRD