Protein Info for PS417_10370 in Pseudomonas simiae WCS417

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 153 to 173 (21 residues), see Phobius details PF00512: HisKA" amino acids 228 to 265 (38 residues), 27.8 bits, see alignment 2.2e-10 PF02518: HATPase_c" amino acids 327 to 432 (106 residues), 86.3 bits, see alignment E=2.1e-28

Best Hits

KEGG orthology group: None (inferred from 69% identity to pba:PSEBR_a3219)

Predicted SEED Role

"sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UDL5 at UniProt or InterPro

Protein Sequence (448 amino acids)

>PS417_10370 ATPase (Pseudomonas simiae WCS417)
MKRLRWPRSLASRLTLIFLTSLVIAHGLSFGLQFYERYQSAMSLMLGNFEQDISTSVAML
ERLPAEERNAWLPRFEHATYRYQLDDGQPGQPMDMATAPASVHSMEAILGQDYGLTFNTI
PDKRPHYQAHLHLRDGTPLTIDVRPQVSPLSPWLPLLLGVQLLLLLGCTLLAVRTAIEPL
TRLANAVDRLDPNGGGARLDEKGPTEVAYAAVAFNTLQERIATHIKERMQLLAAISHDLQ
TPITRMKLRAELMEESLEREKLWNDLSEMQHLVQEGVAYARSMDGTVEASRRVDLHSFLD
SLVFDYQDVGKQVMLTAPTGTVIDTRPHALRRVLVNLVDNALKFGSEVTVNVERHADEHL
SIQILDRGPGIPEAQLPDVVKPFYRVESSRNRTTGGTGLGLAIAQQLAQTLQGGLTLYNR
DGGGLCAQLMLPHCQSPSPSVADQKVAR