Protein Info for GFF2033 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Putrescine transport system permease protein PotH (TC 3.A.1.11.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 121 to 141 (21 residues), see Phobius details amino acids 172 to 194 (23 residues), see Phobius details amino acids 215 to 239 (25 residues), see Phobius details amino acids 243 to 246 (4 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 106 to 294 (189 residues), 29.7 bits, see alignment E=2.6e-11

Best Hits

KEGG orthology group: K11075, putrescine transport system permease protein (inferred from 82% identity to pna:Pnap_2860)

Predicted SEED Role

"Putrescine transport system permease protein PotH (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>GFF2033 Putrescine transport system permease protein PotH (TC 3.A.1.11.2) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MATNIPVPGKRFVIGVPYGWLILFFFLPFLILLYISFVDMGGDISPFKPIWDPVSGILSL
KYENYLAIFRTEEGAPLFRTLYIDAYLRSIWYALCTAVLCLAIGYPFAYFIARSPASIRP
ALLLMVMLPFWTSFLLRVYAWKGILADQGVLNRLLMSIGLISEPIPMLYTNVSMLIGMTY
VYLPFMILPLYANLVKMDFRLLEAAYDLGTSPFKAFWLITVPLSKAGIIAGFMLVFIPCV
GEFVIPSLLGGPENLMIGRVVWDEMFTANDWPRATALAVVMIALIVIPLALYYHYSSDPA
EKR