Protein Info for GFF2024 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Nonspecific acid phosphatase precursor (EC 3.1.3.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01569: PAP2" amino acids 114 to 211 (98 residues), 59.3 bits, see alignment E=1.8e-20

Best Hits

Swiss-Prot: 100% identical to PHON_SALTY: Non-specific acid phosphatase (phoN) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K09474, acid phosphatase (class A) [EC: 3.1.3.2] (inferred from 97% identity to sew:SeSA_A4589)

Predicted SEED Role

"Nonspecific acid phosphatase precursor (EC 3.1.3.2)" (EC 3.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.2

Use Curated BLAST to search for 3.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (250 amino acids)

>GFF2024 Nonspecific acid phosphatase precursor (EC 3.1.3.2) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKSRYLVFFLPLIVAKYTSAETVQPFHSPEESVNSQFYLPPPPGNDDPAYRYDKEAYFKG
YAIKGSPRWKQAAEDADVSVENIARIFSPVVGAKINPKDTPETWNMLKNLLTMGGYYATA
SAKKYYMRTRPFVLFNHSTCRPEDENTLRKNGSYPSGHTAYGTLLALVLSEARPERAQEL
ARRGWEFGQSRVICGAHWQSDVDAGRYVGAVEFARLQTIPAFQKSLAKVREELNDKNNLL
SKEDHPKLNY