Protein Info for PS417_10315 in Pseudomonas simiae WCS417

Annotation: cytochrome C biogenesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 36 to 59 (24 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 117 to 143 (27 residues), see Phobius details amino acids 152 to 177 (26 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details PF00578: AhpC-TSA" amino acids 273 to 376 (104 residues), 50.5 bits, see alignment E=3e-17 PF08534: Redoxin" amino acids 275 to 383 (109 residues), 50.5 bits, see alignment E=3e-17 PF13905: Thioredoxin_8" amino acids 279 to 374 (96 residues), 39.4 bits, see alignment E=9.7e-14

Best Hits

KEGG orthology group: None (inferred from 87% identity to pfs:PFLU2128)

Predicted SEED Role

"DipZ protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U0C1 at UniProt or InterPro

Protein Sequence (402 amino acids)

>PS417_10315 cytochrome C biogenesis protein (Pseudomonas simiae WCS417)
MLLIAFLGGVLTVLSPCILPVVPFLFAGVDRTRRSILLTLGGMVLTFALISSLAVVSTEW
VIQANNTGRHVALIVMGLFALSLISARIGGWLARPFVVLGNRLDPDSRTLSGPLKSVLIG
VATGLLWAPCAGPILGVILTSAMLQGANAQTSLLLVAYGLGSALSLGTLIFAGRGLVNRL
KASIPVTGWLRRGAGVAVLAAAVVISTGADKTLLAGTSSEGVSSLEKGVLENVPKVVDYV
VSKVKADPGQDNANGAMPSLAGAVEWLNSPELTRESLKGKVVLVDFWTYDCINCQHTLPY
VKQWAKKYEKDGLVVIGVHTPEYGYERIIGNVKDQVRKLGITYPVAIDNNYAIWRNFDNQ
YWPAHYLIDAKGQVRYTHFGEGRYDAQEQMIQTLLSEAKAAQ